PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G092900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 750aa    MW: 79534.4 Da    PI: 5.2973
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G092900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.36.3e-28509558251
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
                         ek++sle+l++yFs+++kdAA++Lgvc+T++KriCRq+GI+RWP+Rki++
  Sevir.1G092900.1.p 509 EKTVSLEVLQRYFSGSLKDAARSLGVCPTTMKRICRQHGISRWPFRKIAK 558
                         799*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.564495579IPR003035RWP-RK domain
PfamPF020422.1E-24511558IPR003035RWP-RK domain
SuperFamilySSF542773.6E-19643711No hitNo description
SMARTSM006662.2E-19644737IPR000270PB1 domain
PROSITE profilePS5174520.29644737IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.5E-23645711No hitNo description
PfamPF005643.7E-14645714IPR000270PB1 domain
CDDcd064072.23E-31645736No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MVVGMEVEVD VDGVLQRFDF RLDRGDDGHG RGSDPCASDR SRSGGGGAEG KEVGGGGAVK  60
ERIARALRIY KEAAGDGGGA LVQVWAPARD GGRRVLATRG QPFVLAPPQC HRLFQYRTVS  120
LTHAFPVGGA GVPGERGLPG RVFDAGAPEW TPNVQYYGTG EYARISYALI YDIQAALALP  180
ILEPATGSCV AVIELVTTSP RIRFADEVDK LSKALQEVAL RGSEICRPAP EVCNDDAAEM  240
AMSEVSDILT TVGEAHKLPL AQAWVRCKRC SSSTDDHASL TAAGTPFYLA DADQRLLGFR  300
EDCVEHHLRP GRGGVVEEAA AARGPRFCAD VTKYSMDVYP LAHHARFCGL AGCLAVCVQL  360
RRDGDDASMD DSSREGCVLE FFLPLDCRDG TEQKAAADAI AATITEHFGN GHLKATVISG  420
LEDLSFEIDA DGDCVLRPDP VIMADAPEFE LNDHGGDERD SDEEGLHLAA AVGTADIEAP  480
KMNSGDQNGG EDPRSQVGEK KKKTKRKNEK TVSLEVLQRY FSGSLKDAAR SLGVCPTTMK  540
RICRQHGISR WPFRKIAKAN RSLDKIKRVF ESVPGSSNPM AASTPAATAS HQAPAVATAR  600
GDHALPCLSS ALGVASSQGS CHAPPPPPRD AALRTPLHGV DAGVVTVKAS YKGDIIRFRV  660
PSSAGVATVK REVAKRLGLE ASEFDVKYLD DDNEWVLLSC DADFQECLDV VPALSGTSTS  720
SGSGAAQPVI RLMVQELAEI DGSSCGSSD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954720.10.0PREDICTED: protein NLP3-like
TrEMBLK3YQ880.0K3YQ88_SETIT; Uncharacterized protein
STRINGSi016430m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62692939
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.11e-111Nin-like family protein